PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G085300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family bHLH
Protein Properties Length: 95aa    MW: 10680.1 Da    PI: 9.3646
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G085300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.41.3e-0820601454
                       HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       d+iN+   +L++llP++ + +s K s a +L+ +++YI+ L
  Aqcoe3G085300.1.p 20 DQINDLVIKLQQLLPELRHRSSDKISAAKVLQDTCNYIRGL 60
                       79**************879********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.563660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.67E-102080IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.6E-82075IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.5E-62060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0010086Biological Processembryonic root morphogenesis
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MSSRRSRSRQ SSGSSRITED QINDLVIKLQ QLLPELRHRS SDKISAAKVL QDTCNYIRGL  60
HREVDDLSER LSELLSTTEI STAQAALIRN LLMQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389574.15e-43PREDICTED: transcription factor ILI6-like
SwissprotQ9CA648e-37PRE3_ARATH; Transcription factor PRE3
TrEMBLM0S5Y25e-43M0S5Y2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07410_0011e-42(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.12e-28activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1